PDB entry 1msf

View 1msf on RCSB PDB site
Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices
Deposited on 1995-01-24, released 1995-03-31
The last revision prior to the SCOP 1.69 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1msfC (C:)
    mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevkktswt
    eeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv