Lineage for d1mbe__ (1mbe -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 95027Family a.4.1.3: Myb [46739] (4 proteins)
  6. 95032Protein c-Myb, DNA-binding domain [46740] (2 species)
  7. 95035Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)
  8. 95046Domain d1mbe__: 1mbe - [16038]

Details for d1mbe__

PDB Entry: 1mbe (more details)

PDB Description: mouse c-myb dna-binding domain repeat 1

SCOP Domain Sequences for d1mbe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbe__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
lgktrwtreedeklkklveqngtddwkvianylpnrtdvqcqhrwqkvlnpe

SCOP Domain Coordinates for d1mbe__:

Click to download the PDB-style file with coordinates for d1mbe__.
(The format of our PDB-style files is described here.)

Timeline for d1mbe__: