| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein c-Myb, DNA-binding domain [46740] (1 species) duplication |
| Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries) |
| Domain d1mbha_: 1mbh A: [16036] repeat 2 |
PDB Entry: 1mbh (more details)
SCOPe Domain Sequences for d1mbha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbha_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe
Timeline for d1mbha_: