| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (11 families) ![]() consists only of helices |
| Family a.4.1.3: Myb [46739] (4 proteins) |
| Protein c-Myb, DNA-binding domain [46740] (2 species) duplication |
| Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries) |
| Domain d1idz__: 1idz - [16032] repeat 3 mutant |
PDB Entry: 1idz (more details)
SCOP Domain Sequences for d1idz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idz__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv
Timeline for d1idz__: