SCOP 1.61: Domain d1mnmc_: 1mnm C:

Lineage for d1mnmc_ (1mnm C:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (5 PDB entries)

8. Domain d1mnmc_: 1mnm C: [15983]
   Other proteins in same PDB: d1mnma_, d1mnmb_

Details for d1mnmc_

PDB Entry: 1mnm, 2.25 Å

PDB Description: yeast matalpha2/mcm1/dna ternary transcription complex crystal structure

SCOP Domain Sequences for d1mnmc_:

Sequence; same for both SEQRES and ATOM records:

>d1mnmc_ a.4.1.1 (C:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
glvfnvvtqdminkstkpyrghrftkenvrileswfaknienpyldtkglenlmkntsls
riqiknwvsnrrrkekt

Timeline for d1mnmc_:

• d1mnmc_ first appeared (with stable ids) in SCOP 1.55
  
• d1mnmc_ appears in SCOP 1.59
  
• d1mnmc_ appears in SCOP 1.63
  
• d1mnmc_ appears in the current release, SCOPe 2.08