SCOPe 2.04: Domain d1fcdd1: 1fcd D:1-80

Lineage for d1fcdd1 (1fcd D:1-80)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)

7. Species Chromatium vinosum [TaxId:1049] [46684] (1 PDB entry)

8. Domain d1fcdd1: 1fcd D:1-80 [15968]
   Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3
   complexed with fad, hem

Details for d1fcdd1

PDB Entry: 1fcd, 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

PDB Compounds: (D:) flavocytochrome c sulfide dehydrogenase (cytochrome subunit)

SCOPe Domain Sequences for d1fcdd1:

Sequence; same for both SEQRES and ATOM records:

>d1fcdd1 a.3.1.4 (D:1-80) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Chromatium vinosum [TaxId: 1049]}
eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
ystadfekmagyfkqqtyqp

Timeline for d1fcdd1:

• d1fcdd1 first appeared (with stable ids) in SCOP 1.55
  
• d1fcdd1 appears in SCOPe 2.03
  
• d1fcdd1 appears in SCOPe 2.05
  
• d1fcdd1 appears in the current release, SCOPe 2.08