![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
![]() | Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries) |
![]() | Domain d1n50b1: 1n50 B:5-117 [15950] Other proteins in same PDB: d1n50a2, d1n50b2 complexed with dhe, hec |
PDB Entry: 1n50 (more details), 2.9 Å
SCOP Domain Sequences for d1n50b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n50b1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa} kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp
Timeline for d1n50b1: