Lineage for d1n50b1 (1n50 B:5-117)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1162Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 1163Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 1182Species Pseudomonas aeruginosa [TaxId:287] [46674] (6 PDB entries)
  8. 1194Domain d1n50b1: 1n50 B:5-117 [15950]
    Other proteins in same PDB: d1n50a2, d1n50b2

Details for d1n50b1

PDB Entry: 1n50 (more details), 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1n50b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n50b1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1n50b1:

Click to download the PDB-style file with coordinates for d1n50b1.
(The format of our PDB-style files is described here.)

Timeline for d1n50b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n50b2