Class a: All alpha proteins [46456] (151 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) |
Superfamily a.3.1: Cytochrome c [46626] (7 families) |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries) |
Domain d1n90a1: 1n90 A:6-117 [15945] Other proteins in same PDB: d1n90a2, d1n90b2 |
PDB Entry: 1n90 (more details), 2.9 Å
SCOP Domain Sequences for d1n90a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n90a1 a.3.1.2 (A:6-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa} aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp
Timeline for d1n90a1: