Lineage for d1aofb1 (1aof B:26-133)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 351084Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 351085Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 351091Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 351105Domain d1aofb1: 1aof B:26-133 [15938]
    Other proteins in same PDB: d1aofa2, d1aofb2
    complexed with dhe, hem, so2

Details for d1aofb1

PDB Entry: 1aof (more details), 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

SCOP Domain Sequences for d1aofb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aofb1 a.3.1.2 (B:26-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
epsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdl
trdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaa

SCOP Domain Coordinates for d1aofb1:

Click to download the PDB-style file with coordinates for d1aofb1.
(The format of our PDB-style files is described here.)

Timeline for d1aofb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aofb2