Lineage for d1dw3b_ (1dw3 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 905018Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 905019Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 905027Domain d1dw3b_: 1dw3 B: [15918]
    complexed with hem

Details for d1dw3b_

PDB Entry: 1dw3 (more details), 2.1 Å

PDB Description: structure of a reduced oxygen binding cytochrome c
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d1dw3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw3b_ a.3.1.1 (B:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOPe Domain Coordinates for d1dw3b_:

Click to download the PDB-style file with coordinates for d1dw3b_.
(The format of our PDB-style files is described here.)

Timeline for d1dw3b_: