Lineage for d1dw0c_ (1dw0 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1981134Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 1981135Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 1981138Domain d1dw0c_: 1dw0 C: [15913]
    complexed with hem, so4

Details for d1dw0c_

PDB Entry: 1dw0 (more details), 1.82 Å

PDB Description: structure of oxidized shp, an oxygen binding cytochrome c
PDB Compounds: (C:) cytochrome c

SCOPe Domain Sequences for d1dw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw0c_ a.3.1.1 (C:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOPe Domain Coordinates for d1dw0c_:

Click to download the PDB-style file with coordinates for d1dw0c_.
(The format of our PDB-style files is described here.)

Timeline for d1dw0c_: