SCOPe 2.03: Domain d3etha2: 3eth A:1-78

Lineage for d3etha2 (3eth A:1-78)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain [52446] (1 species)

7. Species Escherichia coli [TaxId:562] [52447] (4 PDB entries)

8. Domain d3etha2: 3eth A:1-78 [158199]
   Other proteins in same PDB: d3etha1, d3etha3, d3ethb1, d3ethb3
   automated match to d1b6ra2
   complexed with atp, mg

Details for d3etha2

PDB Entry: 3eth, 1.6 Å

PDB Description: crystal structure of e. coli purk in complex with mgatp

PDB Compounds: (A:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3etha2:

Sequence; same for both SEQRES and ATOM records:

>d3etha2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]}
mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
qlarhpafvnrdvfpiia

Timeline for d3etha2:

• d3etha2 first appeared in SCOP 1.75
  
• d3etha2 appears in SCOPe 2.02
  
• d3etha2 appears in SCOPe 2.04
  
• d3etha2 appears in the current release, SCOPe 2.08