SCOPe 2.03: Domain d3etha1: 3eth A:277-355

Lineage for d3etha1 (3eth A:277-355)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)

7. Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)

8. Domain d3etha1: 3eth A:277-355 [158198]
   Other proteins in same PDB: d3etha2, d3etha3, d3ethb2, d3ethb3
   automated match to d1b6ra1
   complexed with atp, mg

Details for d3etha1

PDB Entry: 3eth, 1.6 Å

PDB Description: crystal structure of e. coli purk in complex with mgatp

PDB Compounds: (A:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3etha1:

Sequence; same for both SEQRES and ATOM records:

>d3etha1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

Timeline for d3etha1:

• d3etha1 first appeared in SCOP 1.75
  
• d3etha1 appears in SCOPe 2.02
  
• d3etha1 appears in SCOPe 2.04
  
• d3etha1 appears in the current release, SCOPe 2.08