SCOPe 2.06: Domain d3emma_: 3emm A:

Lineage for d3emma_ (3emm A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
   bacterial and plant proteins with a fatty acid binding protein-like fold
   automatically mapped to Pfam PF08768

6. Protein Hypothetical protein At1g79260 [141478] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (4 PDB entries)
   Uniprot O64527 14-166

8. Domain d3emma_: 3emm A: [158186]
   automated match to d2a13a1
   complexed with edo, hem

Details for d3emma_

PDB Entry: 3emm, 1.36 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at1g79260 with bound heme

PDB Compounds: (A:) Uncharacterized protein At1g79260

SCOPe Domain Sequences for d3emma_:

Sequence; same for both SEQRES and ATOM records:

>d3emma_ b.60.1.8 (A:) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl

Timeline for d3emma_:

• d3emma_ first appeared in SCOP 1.75, called d3emma1
  
• d3emma_ appears in SCOPe 2.05
  
• d3emma_ appears in SCOPe 2.07
  
• d3emma_ appears in the current release, SCOPe 2.08