SCOPe 2.04: Domain d3elga1: 3elg A:20-146

Lineage for d3elga1 (3elg A:20-146)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.2: BT0923-like [160574] (2 families)
   Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices

5. Family d.98.2.1: BT0923-like [160575] (3 proteins)
   after putative calcium-regulated periplasmic protein BT0923 (PDB ID 3DUE; new)

6. Protein Putative periplasmic protein BVU2443 [160576] (1 species)

7. Species Bacteroides vulgatus [TaxId:821] [160577] (1 PDB entry)
   Uniprot A6L337 20-146

8. Domain d3elga1: 3elg A:20-146 [158182]
   complexed with cit

Details for d3elga1

PDB Entry: 3elg, 1.64 Å

PDB Description: crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 a resolution

PDB Compounds: (A:) uncharacterized periplasmic protein

SCOPe Domain Sequences for d3elga1:

Sequence; same for both SEQRES and ATOM records:

>d3elga1 d.98.2.1 (A:20-146) Putative periplasmic protein BVU2443 {Bacteroides vulgatus [TaxId: 821]}
agdvvtrdvnklpvaaremigkhfsqtkvayikiekdlfqttsydvkladgielefnskg
ewleidcknksvpstfipqaiskymkanynghktvkiernrkgyeltlenglevdfdqfg
gflklsd

Timeline for d3elga1:

• d3elga1 first appeared in SCOP 1.75
  
• d3elga1 appears in SCOPe 2.03
  
• d3elga1 appears in SCOPe 2.05
  
• d3elga1 appears in the current release, SCOPe 2.08