Lineage for d3ejee_ (3eje E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487379Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1487384Protein Acyl carrier protein [47338] (6 species)
  7. 1487390Species Escherichia coli [TaxId:562] [47339] (14 PDB entries)
    Uniprot P02901
  8. 1487410Domain d3ejee_: 3eje E: [158178]
    Other proteins in same PDB: d3ejeb_, d3ejed_, d3ejef_, d3ejeh_
    automated match to d1t8ka_
    complexed with hem, htg, zmo

Details for d3ejee_

PDB Entry: 3eje (more details), 2.1 Å

PDB Description: crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
PDB Compounds: (E:) Acyl carrier protein

SCOPe Domain Sequences for d3ejee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejee_ a.28.1.1 (E:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
eaekittvqaaidyin

SCOPe Domain Coordinates for d3ejee_:

Click to download the PDB-style file with coordinates for d3ejee_.
(The format of our PDB-style files is described here.)

Timeline for d3ejee_: