![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein Acyl carrier protein [47338] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [47339] (14 PDB entries) Uniprot P02901 |
![]() | Domain d3ejee_: 3eje E: [158178] Other proteins in same PDB: d3ejeb_, d3ejed_, d3ejef_, d3ejeh_ automated match to d1t8ka_ complexed with hem, htg, zmo |
PDB Entry: 3eje (more details), 2.1 Å
SCOPe Domain Sequences for d3ejee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejee_ a.28.1.1 (E:) Acyl carrier protein {Escherichia coli [TaxId: 562]} shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde eaekittvqaaidyin
Timeline for d3ejee_: