Lineage for d3ejda_ (3ejd A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731063Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1731068Protein Acyl carrier protein [47338] (6 species)
  7. 1731074Species Escherichia coli [TaxId:562] [47339] (14 PDB entries)
    Uniprot P02901
  8. 1731088Domain d3ejda_: 3ejd A: [158172]
    Other proteins in same PDB: d3ejdb_, d3ejdd_, d3ejdf_, d3ejdh_
    automated match to d1t8ka_
    complexed with cl, hem, htg, zmq

Details for d3ejda_

PDB Entry: 3ejd (more details), 2.1 Å

PDB Description: crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d3ejda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejda_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
eaekittvqaaidyingh

SCOPe Domain Coordinates for d3ejda_:

Click to download the PDB-style file with coordinates for d3ejda_.
(The format of our PDB-style files is described here.)

Timeline for d3ejda_: