Lineage for d3ehwa_ (3ehw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427749Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries)
  8. 2427750Domain d3ehwa_: 3ehw A: [158154]
    automated match to d4apza_
    complexed with dup, mg

Details for d3ehwa_

PDB Entry: 3ehw (more details), 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site
PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d3ehwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehwa_ b.85.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddtergsggfgstgkn

SCOPe Domain Coordinates for d3ehwa_:

Click to download the PDB-style file with coordinates for d3ehwa_.
(The format of our PDB-style files is described here.)

Timeline for d3ehwa_: