Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries) Uniprot P29477 77-496 ! Uniprot P29477 77-495 |
Domain d3ebfb_: 3ebf B: [158085] automated match to d1jwja_ complexed with 332, h4b, hem, so4 |
PDB Entry: 3ebf (more details), 2.29 Å
SCOPe Domain Sequences for d3ebfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ebfb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq n
Timeline for d3ebfb_: