Lineage for d3e1ka2 (3e1k A:155-373)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203644Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2203645Protein Galactose/lactose metabolism regulatory protein GAL80 [143546] (1 species)
  7. 2203646Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [143547] (2 PDB entries)
    Uniprot Q06433 155-373
  8. 2203648Domain d3e1ka2: 3e1k A:155-373 [157972]
    Other proteins in same PDB: d3e1ka1, d3e1ka3, d3e1kc1, d3e1ke1, d3e1kg1, d3e1ki1, d3e1kk1, d3e1km1, d3e1ko1
    automatically matched to d2nvwa2
    protein/DNA complex

Details for d3e1ka2

PDB Entry: 3e1k (more details), 3 Å

PDB Description: crystal structure of kluyveromyces lactis gal80p in complex with the acidic activation domain of gal4p
PDB Compounds: (A:) Galactose/lactose metabolism regulatory protein GAL80

SCOPe Domain Sequences for d3e1ka2:

Sequence, based on SEQRES records: (download)

>d3e1ka2 d.81.1.5 (A:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngngssng
tdnngaaaikdkekvtkspspstgtseeeqtmevfhlrn

Sequence, based on observed residues (ATOM records): (download)

>d3e1ka2 d.81.1.5 (A:155-373) Galactose/lactose metabolism regulatory protein GAL80 {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
kspyivrakelisegcigdinsieisgnggwygyerpmrspeylydiesgvnlisnsfgh
tidvlqyitgsyfqkinamisnniptqflldengkrtketisktcpdhllfqgilengkv
pvscsfkggtpvkkltknlvidihgtkgdlkiegdagfveisnlvlyfygikngeeqtme
vfhlrn

SCOPe Domain Coordinates for d3e1ka2:

Click to download the PDB-style file with coordinates for d3e1ka2.
(The format of our PDB-style files is described here.)

Timeline for d3e1ka2: