Lineage for d3e0vb1 (3e0v B:88-186)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413578Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2413579Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2413580Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2413581Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2413680Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries)
  8. 2413719Domain d3e0vb1: 3e0v B:88-186 [157951]
    Other proteins in same PDB: d3e0va2, d3e0va3, d3e0va4, d3e0vb2, d3e0vb3, d3e0vb4, d3e0vc2, d3e0vc3, d3e0vc4, d3e0vd2, d3e0vd3, d3e0vd4, d3e0ve2, d3e0ve3, d3e0ve4, d3e0vf2, d3e0vf3, d3e0vf4
    automatically matched to d1pkla1
    complexed with gol, so4

Details for d3e0vb1

PDB Entry: 3e0v (more details), 3.3 Å

PDB Description: crystal structure of pyruvate kinase from leishmania mexicana in complex with sulphate ions
PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d3e0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0vb1 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi
lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl

SCOPe Domain Coordinates for d3e0vb1:

Click to download the PDB-style file with coordinates for d3e0vb1.
(The format of our PDB-style files is described here.)

Timeline for d3e0vb1: