Class a: All alpha proteins [46456] (202 folds) |
Fold a.2: Long alpha-hairpin [46556] (12 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Cambialistic superoxide dismutase [46622] (2 species) active with either Fe or Mn |
Species Porphyromonas gingivalis [TaxId:837] [46624] (1 PDB entry) |
Domain d1qnnd1: 1qnn D:2-84 [15795] Other proteins in same PDB: d1qnna2, d1qnnb2, d1qnnc2, d1qnnd2 complexed with fe; mutant |
PDB Entry: 1qnn (more details), 1.8 Å
SCOP Domain Sequences for d1qnnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnnd1 a.2.11.1 (D:2-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis} thelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqkse ggifnnagqtlnhnlyftqfrpg
Timeline for d1qnnd1: