Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries) |
Domain d3duhb1: 3duh B:1-87 [157885] Other proteins in same PDB: d3duha2, d3duha3, d3duhb2, d3duhb3 automatically matched to d1f42a1 complexed with nag |
PDB Entry: 3duh (more details), 2.3 Å
SCOPe Domain Sequences for d3duhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duhb1 b.1.1.4 (B:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef gdagqytchkggevlshsllllhkked
Timeline for d3duhb1: