Lineage for d3duhb1 (3duh B:1-87)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787390Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)
  7. 787391Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries)
  8. 787394Domain d3duhb1: 3duh B:1-87 [157885]
    Other proteins in same PDB: d3duha2, d3duha3, d3duhb2, d3duhb3
    automatically matched to d1f42a1
    complexed with nag

Details for d3duhb1

PDB Entry: 3duh (more details), 2.3 Å

PDB Description: structure of interleukin-23
PDB Compounds: (B:) Interleukin-12 subunit beta

SCOP Domain Sequences for d3duhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duhb1 b.1.1.4 (B:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

SCOP Domain Coordinates for d3duhb1:

Click to download the PDB-style file with coordinates for d3duhb1.
(The format of our PDB-style files is described here.)

Timeline for d3duhb1: