Class b: All beta proteins [48724] (180 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins) |
Protein Zn-dependent arginine carboxypeptidase [159343] (1 species) |
Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries) |
Domain d3dugg1: 3dug G:5-56,G:360-398 [157878] Other proteins in same PDB: d3duga2, d3dugb2, d3dugc2, d3dugd2, d3duge2, d3dugf2, d3dugg2, d3dugh2 automatically matched to 3BE7 A:3-56,A:360-400 complexed with arg, gol, zn |
PDB Entry: 3dug (more details), 2.62 Å
SCOPe Domain Sequences for d3dugg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dugg1 b.92.1.9 (G:5-56,G:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegfd adivgvienplanirtleevafvmkegkvykr
Timeline for d3dugg1: