PDB entry 3dug

View 3dug on RCSB PDB site
Description: Crystal structure of zn-dependent arginine carboxypeptidase complexed with zinc
Class: hydrolase
Keywords: UNKNOWN SOURCE, AMIDOHYDROLASE, SARGASSO SEA, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, HYDROLASE, New York SGX Research Center for Structural Genomics
Deposited on 2008-07-17, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.231
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3duga1, d3duga2
  • Chain 'B':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugb1, d3dugb2
  • Chain 'C':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugc1, d3dugc2
  • Chain 'D':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugd1, d3dugd2
  • Chain 'E':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3duge1, d3duge2
  • Chain 'F':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugf1, d3dugf2
  • Chain 'G':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugg1, d3dugg2
  • Chain 'H':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUG
    Domains in SCOPe 2.07: d3dugh1, d3dugh2
  • Heterogens: ZN, ARG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dugA (A:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugA (A:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dugB (B:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugB (B:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dugC (C:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugC (C:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dugD (D:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugD (D:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3dugE (E:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugE (E:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3dugF (F:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugF (F:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3dugG (G:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugG (G:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3dugH (H:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dugH (H:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr