Lineage for d3dqvr1 (3dqv R:20-105)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465026Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1465027Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1465028Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1465060Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 1465061Species Human (Homo sapiens) [TaxId:9606] [75694] (6 PDB entries)
    Uniprot P62877 19-106
  8. 1465063Domain d3dqvr1: 3dqv R:20-105 [157828]
    Other proteins in same PDB: d3dqva1
    automatically matched to d1ldjb_
    complexed with zn

Details for d3dqvr1

PDB Entry: 3dqv (more details), 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation
PDB Compounds: (R:) Rbx1

SCOPe Domain Sequences for d3dqvr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqvr1 g.44.1.1 (R:20-105) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
hfhcisrwlktrqvcpldnrewefqk

SCOPe Domain Coordinates for d3dqvr1:

Click to download the PDB-style file with coordinates for d3dqvr1.
(The format of our PDB-style files is described here.)

Timeline for d3dqvr1: