SCOPe 2.08: Domain d3dqvr_: 3dqv R:

Lineage for d3dqvr_ (3dqv R:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
   Uniprot P62877 19-106

8. Domain d3dqvr_: 3dqv R: [157828]
   Other proteins in same PDB: d3dqva2, d3dqva3, d3dqvb1, d3dqvb2
   automated match to d3dplr_
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d3dqvr_

PDB Entry: 3dqv, 3 Å

PDB Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation

PDB Compounds: (R:) Rbx1

SCOPe Domain Sequences for d3dqvr_:

Sequence; same for both SEQRES and ATOM records:

>d3dqvr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
hfhcisrwlktrqvcpldnrewefqk

Timeline for d3dqvr_:

• d3dqvr_ first appeared in SCOP 1.75, called d3dqvr1
  
• d3dqvr_ appears in SCOPe 2.07