| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
| Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries) |
| Domain d3mdsb1: 3mds B:1-92 [15779] Other proteins in same PDB: d3mdsa2, d3mdsb2 complexed with mn3 |
PDB Entry: 3mds (more details), 1.8 Å
SCOPe Domain Sequences for d3mdsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdsb1 a.2.11.1 (B:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp
Timeline for d3mdsb1: