SCOP 1.57: Domain d1mnga1: 1mng A:1-92

Lineage for d1mnga1 (1mng A:1-92)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (3 species)

7. Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)

8. Domain d1mnga1: 1mng A:1-92 [15776]
   Other proteins in same PDB: d1mnga2, d1mngb2

Details for d1mnga1

PDB Entry: 1mng, 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1mnga1:

Sequence; same for both SEQRES and ATOM records:

>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

Timeline for d1mnga1:

• d1mnga1 first appeared (with stable ids) in SCOP 1.55
  
• d1mnga1 appears in SCOP 1.59
  
• d1mnga1 appears in the current release, SCOPe 2.08