PDB entry 1mng

View 1mng on RCSB PDB site
Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Deposited on 1994-07-13, released 1994-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mngA (A:)
    pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
    hlaalpqdiqtavrnnggghlnhslfwrlltpggakepvgelkkaideqfggfqalkekl
    tqaamgrfgsgwawlvkdpfgklhvlstpnqdnpvmegftpivgidvwehayylkyqnrr
    adylqaiwnvlnwdvaeeffkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mngB (B:)
    pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
    hlaalpqdiqtavrnnggghlnhslfwrlltpggakepvgelkkaideqfggfqalkekl
    tqaamgrfgsgwawlvkdpfgklhvlstpnqdnpvmegftpivgidvwehayylkyqnrr
    adylqaiwnvlnwdvaeeffkka