Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
Protein automated matches [190112] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries) |
Domain d3dj8b_: 3dj8 B: [157754] automated match to d1wvaa1 complexed with exy, mn |
PDB Entry: 3dj8 (more details), 1.51 Å
SCOPe Domain Sequences for d3dj8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dj8b_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg laregnhkpidyl
Timeline for d3dj8b_: