Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.13: NIL domain-like [160322] (2 proteins) Pfam PF09383 |
Protein Methionine import ATP-binding protein MetN [160323] (2 species) |
Species Escherichia coli [TaxId:562] [160325] (3 PDB entries) Uniprot P30750 241-343! Uniprot P30750 247-343 |
Domain d3dhwc2: 3dhw C:241-343 [157730] Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc1, d3dhwd1, d3dhwe1, d3dhwf1, d3dhwg1, d3dhwh1 |
PDB Entry: 3dhw (more details), 3.7 Å
SCOPe Domain Sequences for d3dhwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhwc2 d.58.18.13 (C:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv
Timeline for d3dhwc2: