Lineage for d3df3q1 (3df3 Q:3-82)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541821Protein Ribosomal protein S17 [50304] (3 species)
  7. 1541824Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 1541832Domain d3df3q1: 3df3 Q:3-82 [157673]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    automatically matched to 2AVY Q:3-82
    protein/RNA complex; complexed with hyg, mg

Details for d3df3q1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d3df3q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3q1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d3df3q1:

Click to download the PDB-style file with coordinates for d3df3q1.
(The format of our PDB-style files is described here.)

Timeline for d3df3q1: