Lineage for d1i0hb1 (1i0h B:1-90)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149219Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 149315Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 149316Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 149392Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 149403Species Escherichia coli [TaxId:562] [46620] (8 PDB entries)
  8. 149405Domain d1i0hb1: 1i0h B:1-90 [15761]
    Other proteins in same PDB: d1i0ha2, d1i0hb2

Details for d1i0hb1

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

SCOP Domain Sequences for d1i0hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0hb1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1i0hb1:

Click to download the PDB-style file with coordinates for d1i0hb1.
(The format of our PDB-style files is described here.)

Timeline for d1i0hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0hb2