Lineage for d1msda1 (1msd A:1-83)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94371Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 94462Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 94463Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 94532Protein Mn superoxide dismutase (MnSOD) [46618] (4 species)
  7. 94567Species Human (Homo sapiens) [TaxId:9606] [46619] (8 PDB entries)
  8. 94582Domain d1msda1: 1msd A:1-83 [15758]
    Other proteins in same PDB: d1msda2, d1msdb2

Details for d1msda1

PDB Entry: 1msd (more details), 3.2 Å

PDB Description: comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from thermus thermophilus. differences in dimer-dimer interactions.

SCOP Domain Sequences for d1msda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msda1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1msda1:

Click to download the PDB-style file with coordinates for d1msda1.
(The format of our PDB-style files is described here.)

Timeline for d1msda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msda2