SCOPe 2.08: Domain d3dedf_: 3ded F:

Lineage for d3dedf_ (3ded F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Probable hemolysin CV0231 [160841] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [160842] (1 PDB entry)
   Uniprot Q7P1I2 341-427

8. Domain d3dedf_: 3ded F: [157572]
   automated match to d3deda1
   complexed with ca

Details for d3dedf_

PDB Entry: 3ded, 2.14 Å

PDB Description: c-terminal domain of probable hemolysin from chromobacterium violaceum

PDB Compounds: (F:) Probable hemolysin

SCOPe Domain Sequences for d3dedf_:

Sequence; same for both SEQRES and ATOM records:

>d3dedf_ d.145.1.4 (F:) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]}
deivqredgswlvdgmvsldrfreffeleaplpgeaggnihtlagvmlyqlgrvpsvtdr
fewngfsfevvdmdrtrvdkilvqrh

Timeline for d3dedf_:

• d3dedf_ first appeared in SCOP 1.75, called d3dedf1
  
• d3dedf_ appears in SCOPe 2.07