![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Probable hemolysin CV0231 [160841] (1 species) |
![]() | Species Chromobacterium violaceum [TaxId:536] [160842] (1 PDB entry) Uniprot Q7P1I2 341-427 |
![]() | Domain d3dedf_: 3ded F: [157572] automated match to d3deda1 complexed with ca |
PDB Entry: 3ded (more details), 2.14 Å
SCOPe Domain Sequences for d3dedf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dedf_ d.145.1.4 (F:) Probable hemolysin CV0231 {Chromobacterium violaceum [TaxId: 536]} deivqredgswlvdgmvsldrfreffeleaplpgeaggnihtlagvmlyqlgrvpsvtdr fewngfsfevvdmdrtrvdkilvqrh
Timeline for d3dedf_: