| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (8 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries) |
| Domain d3ddqd1: 3ddq D:181-308 [157561] Other proteins in same PDB: d3ddqa_, d3ddqc_ automatically matched to d1vina1 complexed with rrc, sgm |
PDB Entry: 3ddq (more details), 1.8 Å
SCOPe Domain Sequences for d3ddqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddqd1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vlafdlaa
Timeline for d3ddqd1:
View in 3DDomains from other chains: (mouse over for more information) d3ddqa_, d3ddqb1, d3ddqb2, d3ddqc_ |