Lineage for d3ddpb2 (3ddp B:310-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718091Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
  8. 2718119Domain d3ddpb2: 3ddp B:310-432 [157556]
    Other proteins in same PDB: d3ddpa1, d3ddpa2, d3ddpc1, d3ddpc2, d3ddpd3
    automated match to d4eojb2
    complexed with rc8

Details for d3ddpb2

PDB Entry: 3ddp (more details), 2.7 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor CR8
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3ddpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddpb2 a.74.1.1 (B:310-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg
qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet
lnv

SCOPe Domain Coordinates for d3ddpb2:

Click to download the PDB-style file with coordinates for d3ddpb2.
(The format of our PDB-style files is described here.)

Timeline for d3ddpb2: