SCOPe 2.02: Domain d3dbzc1: 3dbz C:235-355

Lineage for d3dbzc1 (3dbz C:235-355)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)

8. Domain d3dbzc1: 3dbz C:235-355 [157530]
   Other proteins in same PDB: d3dbza2, d3dbzb2, d3dbzc2
   automatically matched to d1b08a1
   complexed with ca, mpd

Details for d3dbzc1

PDB Entry: 3dbz, 1.8 Å

PDB Description: human surfactant protein d

PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3dbzc1:

Sequence; same for both SEQRES and ATOM records:

>d3dbzc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d3dbzc1:

• d3dbzc1 first appeared in SCOP 1.75
  
• d3dbzc1 appears in SCOPe 2.01
  
• d3dbzc1 appears in SCOPe 2.03
  
• d3dbzc1 appears in the current release, SCOPe 2.08