Lineage for d1ap5b1 (1ap5 B:1-83)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350503Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 350634Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 350635Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 350739Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 350783Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)
  8. 350801Domain d1ap5b1: 1ap5 B:1-83 [15751]
    Other proteins in same PDB: d1ap5a2, d1ap5b2
    complexed with mn; mutant

Details for d1ap5b1

PDB Entry: 1ap5 (more details), 2.2 Å

PDB Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase

SCOP Domain Sequences for d1ap5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap5b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1ap5b1:

Click to download the PDB-style file with coordinates for d1ap5b1.
(The format of our PDB-style files is described here.)

Timeline for d1ap5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ap5b2