Lineage for d3dbyg2 (3dby G:126-261)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488504Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) (S)
    Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
    automatically mapped to Pfam PF11155
  5. 1488505Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)
  6. 1488506Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)
  7. 1488507Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
    Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124
  8. 1488521Domain d3dbyg2: 3dby G:126-261 [157499]
    automated match to d3dbya2
    complexed with edo, fe

Details for d3dbyg2

PDB Entry: 3dby (more details), 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)
PDB Compounds: (G:) Uncharacterized protein

SCOPe Domain Sequences for d3dbyg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbyg2 a.29.13.1 (G:126-261) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
vfhelhyhlvwltdaaghagsisggldlvekrlkekseeftkhfeqfylkavemtgylrt
elhhfpalkkftkdvslelklfshflheveelelsnevlsvlsarmadhmareecyyllk
laqssglempkcnple

SCOPe Domain Coordinates for d3dbyg2:

Click to download the PDB-style file with coordinates for d3dbyg2.
(The format of our PDB-style files is described here.)

Timeline for d3dbyg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dbyg1