Lineage for d3dbli1 (3dbl I:103-171)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901726Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 901727Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 901728Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 901729Protein Ubiquitin [144347] (4 species)
  7. 901730Species Homo sapiens [TaxId:9606] [161336] (4 PDB entries)
  8. 901733Domain d3dbli1: 3dbl I:103-171 [157481]
    Other proteins in same PDB: d3dbla1, d3dblb1, d3dblc1, d3dbld1, d3dble1, d3dblf1, d3dblg1, d3dblh1
    automatically matched to d1yiwa1
    complexed with zn; mutant

Details for d3dbli1

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (I:) nedd8

SCOP Domain Sequences for d3dbli1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbli1 k.45.1.1 (I:103-171) Ubiquitin {Homo sapiens [TaxId: 9606]}
ikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadykil
ggsvlhlvl

SCOP Domain Coordinates for d3dbli1:

Click to download the PDB-style file with coordinates for d3dbli1.
(The format of our PDB-style files is described here.)

Timeline for d3dbli1: