Lineage for d3dblg1 (3dbl G:6-534)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848423Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 848424Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 848431Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 848432Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion
  7. 848433Species Human (Homo sapiens) [TaxId:9606] [89767] (8 PDB entries)
    Uniprot Q13564
  8. 848450Domain d3dblg1: 3dbl G:6-534 [157479]
    Other proteins in same PDB: d3dblb1, d3dbld1, d3dblf1, d3dblh1, d3dbli1
    automatically matched to d1tt5a_
    complexed with zn; mutant

Details for d3dblg1

PDB Entry: 3dbl (more details), 2.9 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190wt-nedd8ala72gln)
PDB Compounds: (G:) NEDD8-activating enzyme E1 regulatory subunit

SCOP Domain Sequences for d3dblg1:

Sequence, based on SEQRES records: (download)

>d3dblg1 c.111.1.2 (G:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilara
lkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigq
apesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlr
avdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaep
htiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Sequence, based on observed residues (ATOM records): (download)

>d3dblg1 c.111.1.2 (G:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhdhshtpwiviiakylaqwysetngripktykekedfrdlirq
gilkdeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefva
kegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesis
ekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfh
kqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaf
lggaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOP Domain Coordinates for d3dblg1:

Click to download the PDB-style file with coordinates for d3dblg1.
(The format of our PDB-style files is described here.)

Timeline for d3dblg1: