Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins) the common fold is elaborated with additional (sub)domains |
Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species) a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion |
Species Human (Homo sapiens) [TaxId:9606] [89767] (9 PDB entries) Uniprot Q13564 |
Domain d3dblc_: 3dbl C: [157475] Other proteins in same PDB: d3dblb_, d3dbld_, d3dblf_, d3dblh_, d3dbli_, d3dblj_, d3dblk_, d3dbll_ automated match to d1tt5a_ complexed with zn |
PDB Entry: 3dbl (more details), 2.9 Å
SCOPe Domain Sequences for d3dblc_:
Sequence, based on SEQRES records: (download)
>d3dblc_ c.111.1.2 (C:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd lirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilara lkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigq apesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlr avdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaep htiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
>d3dblc_ c.111.1.2 (C:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl dkpfpelrehfqsyddmedhshtpwiviiakylaqwysetngripktykekedfrdlirq gilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkef vakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapes isekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdr fhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtia aflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
Timeline for d3dblc_: