| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries) |
| Domain d1ap6b1: 1ap6 B:1-83 [15747] Other proteins in same PDB: d1ap6a2, d1ap6b2 complexed with mn; mutant |
PDB Entry: 1ap6 (more details), 1.9 Å
SCOP Domain Sequences for d1ap6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap6b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp
Timeline for d1ap6b1: