SCOPe 2.08: Domain d3dara_: 3dar A:

Lineage for d3dara_ (3dar A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)

8. Domain d3dara_: 3dar A: [157466]
   automated match to d3cafa_

Details for d3dara_

PDB Entry: 3dar, 2.2 Å

PDB Description: Crystal structure of D2 domain from human FGFR2

PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3dara_:

Sequence; same for both SEQRES and ATOM records:

>d3dara_ b.1.1.4 (A:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

Timeline for d3dara_:

• d3dara_ first appeared in SCOP 1.75, called d3dara1
  
• d3dara_ appears in SCOPe 2.07