Lineage for d3d7sb1 (3d7s B:1-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650481Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1650482Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1650483Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1650484Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1650605Domain d3d7sb1: 3d7s B:1-100 [157426]
    Other proteins in same PDB: d3d7sa1, d3d7sa2, d3d7sb2, d3d7sc1, d3d7sc2, d3d7sd2
    automated match to d1d09b1
    complexed with zn

Details for d3d7sb1

PDB Entry: 3d7s (more details), 2.8 Å

PDB Description: Crystal structure of Wild-Type E. Coli Asparate Transcarbamoylase at pH 8.5 at 2.80 A Resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d3d7sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d7sb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d3d7sb1:

Click to download the PDB-style file with coordinates for d3d7sb1.
(The format of our PDB-style files is described here.)

Timeline for d3d7sb1: