SCOPe 2.01: Domain d3d70a1: 3d70 A:3-120

Lineage for d3d70a1 (3d70 A:3-120)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (4 proteins)
   includes a dimerisation, antiparallel coiled-coil subdomain

6. Protein Transcription activator BmrR [46963] (1 species)
   followed by long alpha-helical linker

7. Species Bacillus subtilis [TaxId:1423] [46964] (7 PDB entries)
   Uniprot P39075

8. Domain d3d70a1: 3d70 A:3-120 [157416]
   Other proteins in same PDB: d3d70a2
   automatically matched to d1exia1
   protein/DNA complex; complexed with gol, imd; mutant

Details for d3d70a1

PDB Entry: 3d70, 2.8 Å

PDB Description: crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide

PDB Compounds: (A:) BMR promoter DNA

SCOPe Domain Sequences for d3d70a1:

Sequence; same for both SEQRES and ATOM records:

>d3d70a1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d3d70a1:

• d3d70a1 first appeared in SCOP 1.75
  
• d3d70a1 appears in SCOPe 2.02
  
• d3d70a1 appears in the current release, SCOPe 2.08